ABHD5_MOUSE Q9DBL9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DBL9
Recommended name:1-acylglycerol-3-phosphate O-acyltransferase ABHD5
EC number:EC 2.3.1.51
Alternative names:(Abhydrolase domain-containing protein 5) (Lipid droplet-binding protein CGI-58) (Protein CGI-58)
Cleaved into:
GeneID:67469
Gene names (primary ):Abhd5
Gene names (synonym ):
Gene names (ORF ):
Length:351
Mass:39155
Sequence:MKAMAAEEEVDSADAGGGSGWLTGWLPTWCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTVD
Tissue specificity:Highly expressed in the adipose tissue and testes. Weakly expressed in the liver, muscle, kidney, and heart. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and hypothalamus in brain (at protein level). {ECO:0000269|PubMed:15292255, ECO:0000269|PubMed:16679289, ECO:0000269|PubMed:18832586}.
Induction:
Developmental stage:
Protein families:Peptidase S33 family, ABHD4/ABHD5 subfamily