OBP2B_HUMAN Q9NPH6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NPH6
Recommended name:Odorant-binding protein 2b
EC number:
Alternative names:(Odorant-binding protein IIb) (OBPIIb)
Cleaved into:
GeneID:29989
Gene names (primary ):OBP2B
Gene names (synonym ):
Gene names (ORF ):UNQ653/PRO1283
Length:170
Mass:19457
Sequence:MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH
Tissue specificity:Strongly expressed in genital sphere organs such as the prostate and mammary glands.
Induction:
Developmental stage:
Protein families:Calycin superfamily, Lipocalin family