CABL1_MOUSE Q9ESJ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ESJ1
Recommended name：CDK5 and ABL1 enzyme substrate 1
EC number：
Alternative names：(Interactor with CDK3 1) (Ik3-1)
Cleaved into：
GeneID：63955
Gene names (primary )：Cables1
Gene names (synonym )：Cables
Gene names (ORF )：
Length：568
Mass：61429
Sequence：MAAATATAGTAACSSSSSSRGGSTDAAATSGVQPPPPPPATAPPEPLRKPRMDPRRRQAALSFLTNISLDGRPPLQDHEWGGGEEGGGTKPGARARLSLLAAGCNAFSAPGTAAAPWTAGSGSSPCPLPPSLVPRVLGEPSQPPRSAPAVTGAQLQLPDGPGGAGQEELEEDDAFTNVQVPSASFLGSGTPGSTSGSRGRLNSFTQGILPIAFSRQNSQNYCALEQSGQGGSTSALEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTKNGRDLKLDGGRQSAGAMSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGNRRNTIDSTASFSQFRSLSHRSLSMGRAGSTQGSLDAGSDLGDFMDYDPNLLDDPQWPCGKHKRVLTFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGFEEPTVAMAFVYFEKLALRGKLNKQNRKLCAGACVLLAAKVGSDLRKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLIQSS
Tissue specificity：Ubiquitous. Expressed in postnatal day 1 (P1), in postmitotic neurons of the subplate, cortex (V/VI) and marginal zone; in postnatal day 7 (P7), in all layers of the cerebral cortex and in the CA1 and CA2 regions of the hippocampus (at protein level). Highly expressed in brain, kidney, liver and lung. {ECO:0000269|PubMed:10873625, ECO:0000269|PubMed:10896159}.
Induction：
Developmental stage：Expressed in embryo at 15 dpc and strongly expressed in postmitotic neurons of the subplate, cortical plate, subventrical and marginal zones at 18 dpc (at protein level). Expressed in embryo at 7 dpc onwards. {ECO:0000269|PubMed:10896159}.
Protein families：Cyclin family