AROS_MOUSE   Q8C6B9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C6B9

Recommended name:Active regulator of SIRT1

EC number:

Alternative names:(40S ribosomal protein S19-binding protein 1) (RPS19-binding protein 1) (S19BP)

Cleaved into:

GeneID:66538

Gene names  (primary ):Rps19bp1

Gene names  (synonym ):Aros

Gene names  (ORF ):

Length:143

Mass:15978

Sequence:MSAALVRRGLELLAASEAPRAVPGQVQASGTPAKRTRRARAKASQALKLRNSAKGKAPKSALAEYQKRQCRDHLKANLKFMTSMRSTVPESVTQQILQQNQGRKACDRLVAKTKNKKKKKKKAEGTVFTEEDFQKFQREYFGS

Tissue specificity:Widely expressed with higher levels in submaxillary gland and epididymis. {ECO:0000269|PubMed:16289379}.

Induction:

Developmental stage:

Protein families:AROS family


   💬 WhatsApp