GAMT_MOUSE   O35969


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35969

Recommended name:Guanidinoacetate N-methyltransferase

EC number:EC 2.1.1.2

Alternative names:

Cleaved into:

GeneID:14431

Gene names  (primary ):Gamt

Gene names  (synonym ):

Gene names  (ORF ):

Length:236

Mass:26336

Sequence:MSSSAASPLFAPGEDCGPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASRGGRVLEVGFGMAIAASRVQQAPIEEHWIIECNDGVFQRLQDWALRQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCNLTSWGELMKSKYTDITTMFEETQVPALQEAGFLKENICTEVMALVPPADCRYYAFPQMITPLVTKH

Tissue specificity:Highly expressed in testis, caput epididymis, ovary, and liver. In the testis, localized primarily in Sertoli cells. Expressed in brain with high levels in oligodendrocytes and olfactory ensheathing glia. Moderate levels of expression in astrocytes. {ECO:0000269|PubMed:15245487, ECO:0000269|PubMed:8312439}.

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, RMT2 methyltransferase family


   💬 WhatsApp