DUS29_MOUSE Q8BK84
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BK84
Recommended name：Dual specificity phosphatase 29
EC number：EC 3.1.3.16
Alternative names：(Dual specificity phosphatase DUPD1) (EC 3.1.3.48)
Cleaved into：
GeneID：435391
Gene names (primary )：Dusp29
Gene names (synonym )：Dupd1 Dusp27
Gene names (ORF )：
Length：215
Mass：24192
Sequence：MASGDTKTSVKHAHLCAERLSVREEEGDAEDYCTPGAFELERLFWKGSPQYTHVNEVWPRLHIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDVPTFDLSIFFYSAAAFIDSALRDDHSKILVHCAMGRSRSATLVLAYLMIHKNMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVKQRRQAGPGDSDLGL
Tissue specificity：Skeletal muscle, liver and adipose tissue. {ECO:0000269|PubMed:17498703}.
Induction：Deletion of the long non-coding RNA (lncRNA) H19 leads to a decreased DUSP29 expression in muscle (at protein level). Down-regulated in muscle of high-fat diets-induced glucose-intolerant mice (PubMed:30201684). Induced during neurogenic skeletal muscle atrophy (PubMed:32639872). {ECO:0000269|PubMed:30201684, ECO:0000269|PubMed:32639872}.
Developmental stage：Up-regulated during muscle cell differentiation. {ECO:0000269|PubMed:32639872}.
Protein families：Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily