RDH7_RAT P55006
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55006
Recommended name：Retinol dehydrogenase 7
EC number：EC:1.1.1.105
Alternative names：Retinol dehydrogenase 3 Imported Retinol dehydrogenase type III (RODH III)
Cleaved into：
GeneID：360420
Gene names (primary )：Rdh7
Gene names (synonym )：Rdh3 Imported
Gene names (ORF )：
Length：317
Mass：35,737
Sequence：MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISVPMGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKARGRVVNIASTMGRMSLLGGGYCISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGEKFRDSYMKAMESLVNMCSGDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLSDAVIYWGSVKPARAL
Tissue specificity：
Induction：
Developmental stage：
Protein families：