BAMBI_RAT   Q91XN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91XN4

Recommended name:BMP and activin membrane-bound inhibitor homolog

EC number:

Alternative names:

Cleaved into:

GeneID:83837

Gene names  (primary ):Bambi

Gene names  (synonym ):

Gene names  (ORF ):

Length:260

Mass:29,143

Sequence:MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPTMPTLECCHEDMCNYRGLHDVLSPPKSEASGQGNRYQHDSSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQADLSNEKILSLVHWGMYSGHGKLEFV

Tissue specificity:Detected in granulosa and thecal cells of adult ovaries and in spermatogonia, spermatocytes, round spermatids, and Sertoli cells of adult testes. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp