FGF17_RAT P63076
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63076
Recommended name：Fibroblast growth factor 17
EC number：
Alternative names：
Cleaved into：
GeneID：29368
Gene names (primary )：Fgf17
Gene names (synonym )：
Gene names (ORF )：
Length：216
Mass：24,924
Sequence：MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
Tissue specificity：Expressed in embryonic brain, mostly in the isthmus cerebellar neuroepithelium and septum neuroepithelium, and in all adult tissues. 1
Induction：
Developmental stage：Expressed at high level in the brain embryo at 14.5 dpc. Expressed at lower level in the brain embryo at 10.5 dpc and 19.5 dpc. 1
Protein families：