SNP29_RAT   Q9Z2P6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2P6

Recommended name:Synaptosomal-associated protein 29 By Similarity

EC number:

Alternative names:Golgi SNARE of 32 kDa (Gs32) Soluble 29 kDa NSF attachment protein Vesicle-membrane fusion protein SNAP-29

Cleaved into:

GeneID:

Gene names  (primary ):Snap29 By Similarity

Gene names  (synonym ):

Gene names  (ORF ):

Length:257

Mass:29,071

Sequence:MSGYPKSYNPFDDDVEDEDTRPAPWKDARDLPDGPDPPIDRQQYLRQEVLRGPSATAASTSRSLFLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPKNSSLRAYHQKIDSNLDELSVGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL

Tissue specificity:Widely expressed. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp