UPAR_RAT   P49616


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49616

Recommended name:Urokinase plasminogen activator surface receptor

EC number:

Alternative names:CD87

Cleaved into:

GeneID:

Gene names  (primary ):Plaur

Gene names  (synonym ):

Gene names  (ORF ):

Length:328

Mass:35,753

Sequence:MGLLRRRLLLLVVVVTTCVPASQGLRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTGGAPGPGPAHLILIASLLLTLRLWGIPLWT

Tissue specificity:Up-regulated in transformed thyroid cell lines. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp