FABPH_RAT   P07483


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07483

Recommended name:Fatty acid-binding protein, heart

EC number:

Alternative names:

Cleaved into:

GeneID:79131

Gene names  (primary ):Fabp3

Gene names  (synonym ):

Gene names  (ORF ):

Length:133

Mass:14,775

Sequence:MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Tissue specificity:Heart, but also skeletal muscle, kidney, brain and mammary gland.

Induction:

Developmental stage:

Protein families:calycin superfamily


   💬 WhatsApp