PLM_RAT O08589
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08589
Recommended name：Phospholemman By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：RGD:69306
Gene names (primary )：Fxyd1
Gene names (synonym )：Plm 1 Publication
Gene names (ORF )：
Length：92
Mass：10,365
Sequence：MASPGHILIVCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Tissue specificity：In adult brain, highest levels are found in the cerebellum and in the lateral, third and fourth ventricles of the choroid plexus (at protein level) (PubMed:12657675). Also detected in cells of a portion of the ependymal lining of the lateral ventricle on its rostral surface posterior to the caudate putamen (at protein level) (PubMed:12657675). Expressed in a subset of neurons which secrete gonadotropin-releasing hormone (PubMed:19187398). 2 s
Induction：
Developmental stage：In the medial basal hypothalamus, levels are low at birth and increase during neonatal and infantile development to reach a maximum during the mid-to-late juvenile period at postnatal days 24-30. 1
Protein families：FXYD family