CD38_RAT Q64244
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64244
Recommended name:ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
EC number:EC:3.2.2.-
Alternative names:2'-phospho-ADP-ribosyl cyclase 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (EC:2.4.99.20) . EC:2.4.99.20 (UniProtKB | ENZYME | Rhea) 2'-phospho-cyclic-ADP-ribose transferase ADP-ribosyl cyclase 1 (ADPRC 1) CD38H Cyclic ADP-ribose hydrolase 1 (cADPR hydrolase 1)
Cleaved into:
GeneID:25668
Gene names (primary ):Cd38
Gene names (synonym ):
Gene names (ORF ):
Length:303
Mass:34,436
Sequence:MANYEFSQVSEDRPGCRLTRKAQIGLGVGLLLLVALVVVVVIVLWPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV
Tissue specificity:Spleen, liver, heart, thymus, thyroid gland, ileum, colon, cerebellum, salivary gland, adrenal gland, jejunum, islets of Langerhans and osteoclasts. 1
Induction:
Developmental stage:
Protein families: