CANB2_RAT   P28470


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28470

Recommended name:Calcineurin subunit B type 2

EC number:

Alternative names:

Cleaved into:

GeneID:29749

Gene names  (primary ):Ppp3r2

Gene names  (synonym ):Cblp

Gene names  (ORF ):

Length:176

Mass:20,291

Sequence:MGNEASYHSEMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVIDIFDTDGNGEVDFREFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFRDVVRTMEIHKKLVVFVDHGQED

Tissue specificity:Testis specific. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp