PSB9_RAT P28077
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28077
Recommended name：Proteasome subunit beta type-9
EC number：EC:3.4.25.1
Alternative names：Low molecular mass protein 2 Macropain chain 7 Multicatalytic endopeptidase complex chain 7 Proteasome chain 7 Proteasome subunit beta-1i Really interesting new gene 12 protein
Cleaved into：
GeneID：24967
Gene names (primary )：Psmb9
Gene names (synonym )：Lmp2, Ring12
Gene names (ORF )：
Length：219
Mass：23,324
Sequence：MLQAGAPTAGSFRTGEVHTGTTIMAVEFDGGVVVGSDSRVSAGAAVVNRVFDKLSPLHQRIYCALSGSAADAQAIADMAAYQLELHGLELEEPPLVLAAANIVKNISYKYREDLLAHLMVAGWDQHEGGQVYGTMGGMLIRQPFAIGGSGSTYIYGYVDAAYKPGMTPEECRRFTTDAITLAMNRDGSSGGVIYLVTITADGVDHRVILGDELPKFYDE
Tissue specificity：Detected in the cytoplasmic lobe of elongated spermatids, in residual bodies, and in the acrosomal cap of round spermatids. 1
Induction：
Developmental stage：Up-regulated by interferon gamma (at protein level). Up-regulated by theophylline (THP), a reprotoxic agent thought to induce infertility. 1
Protein families：