ICOS_RAT Q9R1T7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1T7
Recommended name：Inducible T-cell costimulator
EC number：
Alternative names：CD278
Cleaved into：
GeneID：
Gene names (primary )：Icos
Gene names (synonym )：Ailim
Gene names (ORF )：
Length：200
Mass：22,529
Sequence：MKPYFSCVFVFCFLIKLLTGELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLPVGCAAFVAALLFGCIFIVWFAKKKYRSSVHDPNSEYMFMAAVNTNKKSRLAGMTS
Tissue specificity：Strongly expressed in the spleen and lung. Lower expression seen in liver, kidney and testis. 1
Induction：
Developmental stage：Expression on T-cells is drastically induced by phorbol myristate acetate (PMA) and Ca-ionophore or the engagement of CD3 and CD28. 1
Protein families：