DELE1_RAT P60924
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60924
Recommended name：DAP3-binding cell death enhancer 1 Imported
EC number：
Alternative names：DAP3-binding cell death enhancer 1 short form By Similarity (DELE1(S) By Similarity; S-DELE1 By Similarity)
Cleaved into：
GeneID：307480
Gene names (primary )：Dele1
Gene names (synonym )：Dele By Similarity
Gene names (ORF )：
Length：509
Mass：55,208
Sequence：MWRLTGILGRALPRLLGPGFRGITPKPTSSDGPQTTSTTLPLPRVNFDRSGSHGSKRNRDPKCCGWKEAFHWMSAHVSPNTLRDAVSWGTLAVLALHLARQIHFHAPLVAGPQSAERCSWHSPLYRFLSSSWWHPHSSLRRHVLPSPDCPAPRNTGLREPRLGQEEPAARSQGLPSDSSLKPGLLNLPEEEPSDFGFLNASRDFTSQAKAAEAGPPGGKNEQDKPKALPLEEAVTSIQQLFQLSVAIAFNFLGTENIKTGDYTAAFSYFQKAADRGYSKAQYNVGLCLEHGRGTPRDLSKAVLFYHLAAVQGHSLAQYRYARCLLQSPGSMSDPERQRAVSLLKQAADSGLTEAQAFLGVLFTKEPHLDEQKAVKYFWLAASNGDSQSRFHLGICYEKGLGVQRNLGEAVKCYQKSAAMGNEPAQERLRTLFNVEAAGPSHLAIGLKSFSSPSLCSLNTFLAGASGLPHASSTGNLGLLCRSGHLGTSHGAPSRAMPSLERSLVRLGFG
Tissue specificity：
Induction：
Developmental stage：
Protein families：DELE1 family