PLAT3_RAT P53817
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53817
Recommended name：Phospholipase A and acyltransferase 3 Curated
EC number：EC:2.3.1.-
Alternative names：Group XVI phospholipase A2 Imported H-rev 107 protein homolog By Similarity HRAS-like suppressor 3 By Similarity (HRSL3 By Similarity) Rat LRAT-like protein-3 1 Publication (RLP-3 1 Publication)
Cleaved into：
GeneID：24913
Gene names (primary )：Plaat3
Gene names (synonym )：H-rev107 By Similarity, Hrasls3 By Similarity, Hrev107 By Similarity, Pla2g16 Imported, Rlp-3 1 Publication
Gene names (ORF )：
Length：160
Mass：17,749
Sequence：MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ
Tissue specificity：Specifically expressed in H-ras resistant fibroblasts. 2 s
Induction：
Developmental stage：Induced during preadipocyte differentiation into adipocytes. 1
Protein families：H-rev107 family