NACC1_RAT O35260
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35260
Recommended name：Nucleus accumbens-associated protein 1
EC number：
Alternative names：BTB/POZ domain-containing protein 14B
Cleaved into：
GeneID：
Gene names (primary )：Nacc1
Gene names (synonym )：Btbd14b, Nac1
Gene names (ORF )：
Length：514
Mass：56,450
Sequence：MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVELPAAVQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHPEEAPSSEPQSPVAQILGWPACSTPLPLVSRVKTEQELDSVQCTPMAKRLWDSSQKEAGGSGGNNGSRKMAKFSTPDLAPNRMPQPVSVATATAAVAVVAVGGCVSGPSMSERTSPGTSSAYTSDSPSSYHNEEDEEEDAGEEGTDEQYRQICNMYTMYSMLNVGQTVEKVEALPEQVVLESHSRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWLPKTKPLHLVEGDNYSSFISDTGKIEPDMMSMEHSFETASHDGEAGPSAEVLQ
Tissue specificity：Highly expressed in the hippocampus, brain cortex, cerebellum and brainstem. Expressed in the nucleus accumbens, olfactory tubercle, the striatum, frontal and parietal cortex and ventral pallidum. Weakly expressed in the heart, liver, kidney, spleen, testis, and skeletal muscle. Isoform 2 is expressed in the brain and liver, less abundantly expressed in the brain than isoform 1. 1
Induction：Expressed in the brain at 16 dpc, 18 dpc, P2, P8 and P90. 2 Publications
Developmental stage：Expression is increased by cocaine, selectively in the nucleus accumbens. mRNA is present at increased levels in the nucleus accumbens 3 weeks after withdrawal from cocaine self-administration. 1
Protein families：