PDPN_RAT Q64294
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64294
Recommended name:Podoplanin 1 Publication
EC number:
Alternative names:
Cleaved into:
GeneID:54320
Gene names (primary ):Pdpn
Gene names (synonym ):
Gene names (ORF ):
Length:166
Mass:17,579
Sequence:MWTAPVLLWVLGSVWFWDSAQGGAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLVGIIIGVLLAIGFIGGIIIVVMRKISGRFSP
Tissue specificity:In adult kidney, expressed on the urinary surface and foot processes of podocytes and in parietal epithelial cells of Bowman's capsule where it is localized to luminal surfaces. In lung, expressed exclusively on luminal surfaces of type I alveolar epithelial cells and pleural mesothelial cells. Not expressed in type II alveolar cells. In bone, expressed in osteocytes and osteoblasts. In spleen, liver, stomach and intestine, expressed in mesoepithelium. Also expressed in thymic epithelial cells, choroid plexus and leptomeninges. 2 s
Induction:
Developmental stage:In newborn kidney, not detected at the vesicle stage. First detected in S-shaped bodies. 1
Protein families:podoplanin family