PCSK7_RAT Q62849
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62849
Recommended name:Proprotein convertase subtilisin/kexin type 7
EC number:EC:3.4.21.-
Alternative names:Prohormone convertase 7 Proprotein convertase 7 (PC7; rPC7) Subtilisin/kexin-like protease PC7
Cleaved into:
GeneID:29606
Gene names (primary ):Pcsk7
Gene names (synonym ):Pc7
Gene names (ORF ):
Length:783
Mass:85,599
Sequence:MPKGRQKVPRLDARLGLPICLCLELAIFFLVPQVMGLTEAGGLDTLGAGGLSWAVHLDSLEGERKEESLIQQANAVAQAAGLVNAGRIGELQGHYLFVQPAGHGQAMEAEAMRQQAEAVLAKHEAVRWHSEQRLLKRAKRSIHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTVQDIAPNYSPEGSYDLNSNDPDPMPHPDEENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVMAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATQYEDHRADWLTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPMLKENKAVPRSPHSLEVLWNVSRTDLEMSGLKTLEHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGVYRLVIRDVGDEPLQVGILQQWQLTLYGSTWSPVDIKDRQSLLESAMSGKYLHDDFTLPCPPGLKIPEEDGYSITPNTLKTLVLVGCFSVFWTIYYMLEVCLSQRSKASTHGCRRGCCPWPPQSQNSKEVGTALESMPLCSSKDLDGVDSEHGDCTTASSLLAPELLGEADWSLSQNSKSDLDCPPHQPPDLKDGQIC
Tissue specificity:Widely expressed. Highly expressed in colon and spleen. 1
Induction:
Developmental stage:
Protein families: