PLAT1_RAT   D2KX21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D2KX21

Recommended name:Phospholipase A and acyltransferase 1 Curated

EC number:EC:2.3.1.-

Alternative names:HRAS-like suppressor 1 (HRSL1) Phospholipid-metabolizing enzyme A-C1 Rat LRAT-like protein-2 1 Publication (RLP-2 1 Publication)

Cleaved into:

GeneID:288025

Gene names  (primary ):Plaat1

Gene names  (synonym ):A-C1, Hrasls Imported, Hrasrs, RLP-2 1 Publication

Gene names  (ORF ):rCG_36537 Imported

Length:167

Mass:18,521

Sequence:MAVNDCFSLTYPHNPHPGDLIEVFRPCYQHWALYLGDGYVINIAPVDGIPSSFSSAKSVFSTKALVKMQLLKDVVGNDTYRINNKYDTTYPPLPVEEVIQRSEFAIGQEVTYDLLVNNCEHFVTLLRYGEGVSEQANRAIGTIGLVAAGIDIFTFLGLFPKRQGAKS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp