COLQ_RAT O35167
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35167
Recommended name:Acetylcholinesterase collagenic tail peptide
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Colq
Gene names (synonym ):
Gene names (ORF ):
Length:458
Mass:47,912
Sequence:MAVLNPMTLGIYLQLFFCSIVSQPTFINSVLPISAALPGLDQKKRGNHKACCLLMPPPPPLFPPPFFRGSRSPLLSPDMKNLLELEASPSPCMQGSLGSPGPPGPQGPPGLPGKAGPKGEKGDLGRPGRKGRPGPPGVPGEPGPVGWPGPEGPRGEKGDVGMMGLPGSRGPMGSKGFPGSRGEKGSRGERGDLGPKGEKGFPGFPGMLGQKGEMGPKGESGIAGHRGPTGRPGKRGKQGQKGDSGIMGPPGKPGPSGQPGRQGPPGPPGPPSAGQLVMGLKGERGFPGPPGRCLCGPPANVNNPSYGDPMYGRGSPRVPAIFVVNNQEELEKLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVGLHHKAAWHLCGDGVLQPGEECDDGNPDVSDGCIDCHRAYCGDGYRHRGVEDCDGSDFGYLKCETYLPGSYGELRCTQYCSIDSTPCRYFT
Tissue specificity:Expressed in skeletal muscle, heart, brain, as well as in lung, spleen, testis, but not liver. The short isoform represents about 5% of the transcripts in the soleus muscle and about 15% in the heart ventricle.
Induction:
Developmental stage:
Protein families:COLQ family