UBL5_HUMAN   Q9BZL1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZL1

Recommended name:Ubiquitin-like protein 5

EC number:

Alternative names:

Cleaved into:

GeneID:59286

Gene names  (primary ):UBL5

Gene names  (synonym ):

Gene names  (ORF ):

Length:73

Mass:8547

Sequence:MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Tissue specificity:Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts. {ECO:0000269|PubMed:11161819}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp