NDUA5_HUMAN   Q16718


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q16718

Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

EC number:

Alternative names:(Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit)

Cleaved into:

GeneID:4698

Gene names  (primary ):NDUFA5

Gene names  (synonym ):

Gene names  (ORF ):

Length:116

Mass:13459

Sequence:MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Tissue specificity:Expressed in all tissues examined with highest levels in heart, skeletal muscle and brain. {ECO:0000269|PubMed:9048877}.

Induction:

Developmental stage:

Protein families:Complex I NDUFA5 subunit family


   💬 WhatsApp