ZN593_HUMAN O00488
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00488
Recommended name:Zinc finger protein 593
EC number:
Alternative names:(Zinc finger protein T86)
Cleaved into:
GeneID:51042
Gene names (primary ):ZNF593
Gene names (synonym ):ZT86
Gene names (ORF ):
Length:134
Mass:15199
Sequence:MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
Tissue specificity:Ubiquitous. Detected in spleen, prostate, testis, small intestine, colon and to a minor level in thymus and peripheral blood leukocytes.
Induction:
Developmental stage:
Protein families:ZNF593/BUD20 C2H2-type zinc-finger protein family