TEX37_HUMAN Q96LM6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96LM6
Recommended name：Testis-expressed sequence 37 protein
EC number：
Alternative names：(Testis-specific conserved protein of 21 kDa)
Cleaved into：
GeneID：200523
Gene names (primary )：TEX37
Gene names (synonym )：C2orf51 TSC21
Gene names (ORF )：
Length：180
Mass：20615
Sequence：MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ
Tissue specificity：Testis-specific (PubMed:17091336, PubMed:26168773). Detected in the germ cell lineage at all stages (PubMed:26168773). {ECO:0000269|PubMed:17091336, ECO:0000269|PubMed:26168773}.
Induction：
Developmental stage：
Protein families：