RPP21_HUMAN Q9H633
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H633
Recommended name：Ribonuclease P protein subunit p21
EC number：EC:3.1.26.5
Alternative names：(RNaseP protein p21) (Ribonuclease P/MRP 21 kDa subunit) (Ribonucleoprotein V)
Cleaved into：
GeneID：79897
Gene names (primary )：RPP21
Gene names (synonym )：C6orf135 CAT60
Gene names (ORF )：
Length：154
Mass：17570
Sequence：MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic/archaeal RNase P protein component 4 family