RGS19_HUMAN P49795
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49795
Recommended name：Regulator of G-protein signaling 19
EC number：
Alternative names：(RGS19) (G-alpha-interacting protein) (GAIP)
Cleaved into：
GeneID：10287
Gene names (primary )：RGS19
Gene names (synonym )：GAIP GNAI3IP
Gene names (ORF )：
Length：217
Mass：24636
Sequence：MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
Tissue specificity：Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.
Induction：
Developmental stage：
Protein families：