DAOA_HUMAN   P59103


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59103

Recommended name:D-amino acid oxidase activator

EC number:

Alternative names:(Protein G72)

Cleaved into:

GeneID:267012

Gene names  (primary ):DAOA

Gene names  (synonym ):G72

Gene names  (ORF ):

Length:153

Mass:18108

Sequence:MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Tissue specificity:Expressed in amygdala, caudate nucleus, spinal cord and testis.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp