1433F_HUMAN   Q04917


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04917

Recommended name:14-3-3 protein eta

EC number:

Alternative names:(Protein AS1)

Cleaved into:

GeneID:7533

Gene names  (primary ):YWHAH

Gene names  (synonym ):YWHA1

Gene names  (ORF ):

Length:246

Mass:28219

Sequence:MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Tissue specificity:Expressed mainly in the brain and present in other tissues albeit at lower levels.

Induction:

Developmental stage:

Protein families:14-3-3 family


   💬 WhatsApp