OCAD1_HUMAN Q9NX40
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NX40
Recommended name：OCIA domain-containing protein 1
EC number：
Alternative names：(Ovarian cancer immunoreactive antigen domain containing 1) (Ovarian carcinoma immunoreactive antigen)
Cleaved into：
GeneID：54940
Gene names (primary )：OCIAD1
Gene names (synonym )：ASRIJ OCIA
Gene names (ORF )：
Length：245
Mass：27626
Sequence：MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Tissue specificity：Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord. {ECO:0000269|PubMed:11162530}.
Induction：
Developmental stage：
Protein families：OCIAD1 family