NIPS2_HUMAN   O75323


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75323

Recommended name:Protein NipSnap homolog 2

EC number:

Alternative names:(NipSnap2) (Glioblastoma-amplified sequence)

Cleaved into:

GeneID:2631

Gene names  (primary ):NIPSNAP2

Gene names  (synonym ):GBAS

Gene names  (ORF ):

Length:286

Mass:33743

Sequence:MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ

Tissue specificity:Widely expressed. Most abundant in heart and skeletal muscle.

Induction:

Developmental stage:

Protein families:NipSnap family


   💬 WhatsApp