ML12B_HUMAN O14950
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14950
Recommended name：Myosin regulatory light chain 12B
EC number：
Alternative names：(MLC-2A) (MLC-2) (Myosin regulatory light chain 2-B, smooth muscle isoform) (Myosin regulatory light chain 20 kDa) (MLC20) (Myosin regulatory light chain MRLC2) (SHUJUN-1)
Cleaved into：
GeneID：103910
Gene names (primary )：MYL12B
Gene names (synonym )：MRLC2 MYLC2B
Gene names (ORF )：
Length：172
Mass：19779
Sequence：MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Tissue specificity：Ubiquitously expressed in various hematopoietic cells. {ECO:0000269|PubMed:11436981, ECO:0000269|PubMed:18480596}.
Induction：
Developmental stage：
Protein families：