MGST3_HUMAN O14880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14880
Recommended name：Microsomal glutathione S-transferase 3
EC number：EC:1.11.1.-
Alternative names：(Microsomal GST-3) (Glutathione peroxidase MGST3) (LTC4 synthase MGST3) (Microsomal glutathione S-transferase III) (Microsomal GST-III)
Cleaved into：
GeneID：4259
Gene names (primary )：MGST3
Gene names (synonym )：
Gene names (ORF )：
Length：152
Mass：16516
Sequence：MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Tissue specificity：Predominantly expressed in heart, skeletal muscle, and adrenal cortex. Also found in brain, placenta, liver, kidney, pancreas, thyroid, testis and ovary. Almost absent in lung, thymus and peripheral blood leukocytes. {ECO:0000269|PubMed:9278457}.
Induction：
Developmental stage：
Protein families：MAPEG family