MED22_HUMAN Q15528
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15528
Recommended name：Mediator of RNA polymerase II transcription subunit 22
EC number：
Alternative names：(Mediator complex subunit 22) (Surfeit locus protein 5) (Surf-5)
Cleaved into：
GeneID：6837
Gene names (primary )：MED22
Gene names (synonym )：SURF5
Gene names (ORF )：
Length：200
Mass：22221
Sequence：MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mediator complex subunit 22 family