M14OS_HUMAN   P0DP75


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DP75

Recommended name:Putative uncharacterized protein MED14OS

EC number:

Alternative names:(MED14 antisense gene protein 1) (MED14 opposite strand protein)

Cleaved into:

GeneID:100873985

Gene names  (primary ):MED14OS

Gene names  (synonym ):MED14-AS1

Gene names  (ORF ):

Length:135

Mass:14289

Sequence:MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp