LCN6_HUMAN   P62502


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62502

Recommended name:Epididymal-specific lipocalin-6

EC number:

Alternative names:(Lipocalin-5)

Cleaved into:

GeneID:158062

Gene names  (primary ):LCN6

Gene names  (synonym ):LCN5

Gene names  (ORF ):UNQ643/PRO1273

Length:163

Mass:18045

Sequence:MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ

Tissue specificity:Predominantly expressed in epididymis.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp