LTOR3_HUMAN   Q9UHA4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UHA4

Recommended name:Ragulator complex protein LAMTOR3

EC number:

Alternative names:(Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3) (MEK-binding partner 1) (Mp1) (Mitogen-activated protein kinase kinase 1-interacting protein 1) (Mitogen-activated protein kinase scaffold protein 1)

Cleaved into:

GeneID:8649

Gene names  (primary ):LAMTOR3

Gene names  (synonym ):MAP2K1IP1 MAPKSP1

Gene names  (ORF ):PRO2783

Length:124

Mass:13623

Sequence:MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Tissue specificity:

Induction:

Developmental stage:

Protein families:LAMTOR3 family


   💬 WhatsApp