H2B1B_HUMAN P33778
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P33778
Recommended name：Histone H2B type 1-B
EC number：
Alternative names：(H2B-clustered histone 3) (Histone H2B.1) (Histone H2B.f) (H2B/f)
Cleaved into：
GeneID：3018
Gene names (primary )：H2BC3
Gene names (synonym )：H2BFF HIST1H2BB
Gene names (ORF )：
Length：126
Mass：13950
Sequence：MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2B family