GFRP_HUMAN   P30047


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30047

Recommended name:GTP cyclohydrolase 1 feedback regulatory protein

EC number:

Alternative names:(GFRP) (GTP cyclohydrolase I feedback regulatory protein) (p35)

Cleaved into:

GeneID:2644

Gene names  (primary ):GCHFR

Gene names  (synonym ):GFRP

Gene names  (ORF ):

Length:84

Mass:9698

Sequence:MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Tissue specificity:In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level). {ECO:0000269|PubMed:16778797}.

Induction:

Developmental stage:

Protein families:GFRP family


   💬 WhatsApp