MPZL2_HUMAN   O60487


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O60487

Recommended name:Myelin protein zero-like protein 2

EC number:

Alternative names:(Epithelial V-like antigen 1)

Cleaved into:

GeneID:10205

Gene names  (primary ):MPZL2

Gene names  (synonym ):EVA EVA1

Gene names  (ORF ):UNQ606/PRO1192

Length:215

Mass:24484

Sequence:MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD

Tissue specificity:Widely expressed. In fetal tissues, highest expression in the inner ear. In adult tissues, highest levels in thymus and lung. {ECO:0000269|PubMed:29961571}.

Induction:

Developmental stage:

Protein families:Myelin P0 protein family


   💬 WhatsApp