NP5_HUMAN P61583
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61583
Recommended name:Endogenous retrovirus group K member 5 Np9 protein
EC number:
Alternative names:(Endogenous retrovirus K protein 5) (HERV-K(II) Np9 protein) (HERV-K_3q12.3 provirus Np9 protein)
Cleaved into:
GeneID:
Gene names (primary ):ERVK-5
Gene names (synonym ):ERVK5
Gene names (ORF ):
Length:75
Mass:8907
Sequence:MNPSEMQRKGPPQRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHRRLHFVLY
Tissue specificity:
Induction:
Developmental stage:
Protein families: