ELOC_HUMAN   Q15369


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15369

Recommended name:Elongin-C

EC number:

Alternative names:(EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1)

Cleaved into:

GeneID:6921

Gene names  (primary ):ELOC

Gene names  (synonym ):TCEB1

Gene names  (ORF ):

Length:112

Mass:12473

Sequence:MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Tissue specificity:Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. {ECO:0000269|PubMed:12004003}.

Induction:

Developmental stage:

Protein families:SKP1 family


   💬 WhatsApp