F107A_HUMAN O95990
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95990
Recommended name：Actin-associated protein FAM107A
EC number：
Alternative names：(Down-regulated in renal cell carcinoma 1) (Protein TU3A)
Cleaved into：
GeneID：11170
Gene names (primary )：FAM107A
Gene names (synonym )：DRR1 TU3A
Gene names (ORF )：
Length：144
Mass：17455
Sequence：MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Tissue specificity：Widely expressed (PubMed:10564580). Expressed in neurons (PubMed:20543869). Expressed in malignant glial tumors (PubMed:20543869). Expression is reduced or absent in a number of cancer cell lines (PubMed:10564580). {ECO:0000269|PubMed:10564580, ECO:0000269|PubMed:20543869}.
Induction：
Developmental stage：
Protein families：FAM107 family