PAPAS_HUMAN   Q5QFB9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5QFB9

Recommended name:Protein PAPPAS

EC number:

Alternative names:(DIPLA1 antisense RNA 1) (DIPLA1 antisense gene protein 1) (DIPLA1-antisense expressed) (PAPPAS antisense RNA 1) (PAPPAS antisense gene protein 1) (PAPPAS-antisense expressed)

Cleaved into:

GeneID:

Gene names  (primary ):PAPPA-AS1

Gene names  (synonym ):DIPAS PAPPAS

Gene names  (ORF ):

Length:102

Mass:12196

Sequence:MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLSVIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF

Tissue specificity:Expressed in placenta with lower expression in brain, kidney and testis. {ECO:0000269|PubMed:15656990}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp