TXN4B_HUMAN   Q9NX01


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NX01

Recommended name:Thioredoxin-like protein 4B

EC number:

Alternative names:(Dim1-like protein)

Cleaved into:

GeneID:54957

Gene names  (primary ):TXNL4B

Gene names  (synonym ):DIM2 DLP

Gene names  (ORF ):

Length:149

Mass:17015

Sequence:MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Tissue specificity:

Induction:

Developmental stage:

Protein families:DIM1 family


   💬 WhatsApp