DNJ5B_HUMAN   Q9UF47


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UF47

Recommended name:DnaJ homolog subfamily C member 5B

EC number:

Alternative names:(Cysteine-string protein isoform beta) (CSP-beta)

Cleaved into:

GeneID:85479

Gene names  (primary ):DNAJC5B

Gene names  (synonym ):CSPBETA

Gene names  (ORF ):

Length:199

Mass:22496

Sequence:MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS

Tissue specificity:Testis specific.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp