CHMP3_HUMAN   Q9Y3E7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y3E7

Recommended name:Charged multivesicular body protein 3

EC number:

Alternative names:(Chromatin-modifying protein 3) (Neuroendocrine differentiation factor) (Vacuolar protein sorting-associated protein 24) (hVps24)

Cleaved into:

GeneID:100526767

Gene names  (primary ):CHMP3

Gene names  (synonym ):CGI149 NEDF VPS24

Gene names  (ORF ):CGI-149

Length:222

Mass:25073

Sequence:MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS

Tissue specificity:Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:15632132}.

Induction:

Developmental stage:

Protein families:SNF7 family


   💬 WhatsApp